DPCstruct | MC18256
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 74 ± 8 aa |
| Standard deviation of domain lengths | 8.49 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 81.96 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 27.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4NMB9 | 3-68 | TEEVYRKLYAELEKYEEEGVDMRIDGYQASPMQIVTAHMIKEEGTYMRDYVINPEGNIERLSFVNI |
| A0A417U8W1 | 4-69 | RNETSSQVLYENLKKWEETGVRLYLDGVPASLKSIEQNCVMEDSMYMPDYVTDQNGKITEIRYDRI |
| A0A3E3IFF1 | 67-135 | None |
| A0A1Q9JUA9 | 3-64 | None |
| A5KQX4 | 15-99 | None |
| A0A3N1XG64 | 9-81 | None |
| A0A1Q6N977 | 21-89 | None |
| A0A1C5PJH2 | 8-89 | None |
| A0A351TT73 | 44-119 | None |
| A0A1Y4GYN2 | 6-73 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.