DPCstruct | MC18254
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 107 ± 17 aa |
| Standard deviation of domain lengths | 16.74 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 88.20 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 31.98 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09614 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| G9YI72 | 6-99 | AVYNTKEQHEGNAEWIKSKKESGWLVPIAVGFKRISEIGKIKGQRDKSKNHCFVEPVVTIGEFKMAYRFESIDDMMWHYEYKENEKL… |
| A0A378Q8W6 | 2-97 | DNRKATWERYVPPNKKGWIVPLMIGYKAISPLYDPNTVENLRDTRYPFRFVEAVHGLGEWRSLHRIADISDVIWQYQIEDNWYLCRQ… |
| A0A0Q4NFP5 | 145-300 | None |
| A0A6P1Q8S3 | 74-172 | None |
| A0A257PV92 | 188-320 | None |
| A0A272EN45 | 19-119 | None |
| G9Y1C5 | 104-210 | None |
| A0A1C0TZP3 | 12-113 | None |
| A0A149RB78 | 147-244 | None |
| A0A1M5VIR8 | 675-779 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.