DPCstruct | MC18252
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 60 ± 8 aa |
| Standard deviation of domain lengths | 8.17 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 87.88 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 32.85 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19668 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2V2YXV1 | 1-76 | MTDAQIQRLLASPMFSSPELVVSDEIYEQRIAACAACPKLVSGVTCQACGCIIPVVAKLKQRGCPLPGGGLWQAVV |
| A0A383B3F6 | 68-119 | KVKLSKGEAEARMKICMSCEEYIKEENRCNLCGCYMRVKTRIATERCPIRKW |
| A0A329ZLS7 | 2-57 | None |
| A0A4V0WPD1 | 2-78 | None |
| A0A352KUJ5 | 55-110 | None |
| A0A5M9X1P4 | 1-66 | None |
| A0A329ZX11 | 239-288 | None |
| A0A6M0EP50 | 36-90 | None |
| A0A2D2ATH8 | 91-144 | None |
| A0A2D6XBS8 | 54-118 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.