DPCstruct | MC1825
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 205 ± 39 aa |
| Standard deviation of domain lengths | 38.79 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 69.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 40.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0S7M3D3 | 236-404 | QDEDDEDLESEDVFEPNLPQKEHSNHNSYSWCLMRLAMVQLVLVNLKSFYPMAGYDLLDLPVASPLCHAVLKTLQRWEQVLQKRLEL… |
| A0A183J520 | 1-244 | MTDSDSDIEHEPAVAAKIQQQQSYLDPNSYAWLILRLALVRQAFYRVKQFVGLCGLDFSEIGTQSPLIRCSLLTLEEWMYSITAELD… |
| A0A0S7M2W5 | 134-302 | None |
| A0A1I7WD23 | 591-807 | None |
| A0A3P7FPV9 | 833-1092 | None |
| A0A7J8IHF2 | 813-967 | None |
| A0A1U8CUH3 | 2-182 | None |
| A0A158Q409 | 1295-1540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.