DPCstruct | MC18249
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 143 ± 17 aa |
| Standard deviation of domain lengths | 17.45 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4P7WEA6 | 7-156 | VFDFEGNSVRSFHRISMSMRRKLDFARIKMSLEQWGKLSQEQRKMLFNAPCTGDAESSQHYAKLVREAVKQAAGEEVKALTDPRFDL… |
| A0A2E8MDV8 | 4-160 | TASTTERVLDIERAADPGGELIPLLVRMKLDLAGARLHLADWQTLSECERQALIEAPVGNLAAADAYFSLLQAMLAAAGRAAIDRAQ… |
| A0A2W5WR96 | 43-211 | None |
| A0A2W4M6J7 | 13-136 | None |
| A0A381N4G7 | 17-156 | None |
| A0A7G8GPY8 | 2-125 | None |
| A0A356TC76 | 13-132 | None |
| A0A7G8F070 | 1-114 | None |
| A0A7Y5KR52 | 1-153 | None |
| A0A4Q3UCT8 | 4-165 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.