DPCstruct | MC18246
Metacluster Properties and Pfam Annotations
| Number of structural domains | 106 |
|---|---|
| Mean domain length (aa) | 104 ± 14 aa |
| Standard deviation of domain lengths | 13.91 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 29.97 |
| Pfam Score | 96.88 |
| Assigned Pfam label(s) | PF12571- CL0064- PF10983 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| K6E2V0 | 156-260 | SAQKINTEIYNAIRGLEWQDSVKSKTITAPPASPIKNDRYLIPSNATGAWSGKGDQVVHYNGAAWEYYVPNLGWSIYVDSENKNYVY… |
| A0A7Y2IZW1 | 3-78 | LTLASRAITAPPGTAEEGACYAVPAGAVNAWDGQAGRLALFVGGGWDFLDPVTGWRAWIADEGVPGVFDGVDWVAG |
| A0A250KPR8 | 6-87 | None |
| A0A3C1GAA7 | 116-205 | None |
| A0A2E1CTG0 | 30-132 | None |
| A0A7C3V220 | 51-157 | None |
| A0A1A9G110 | 56-156 | None |
| A0A1Q3WRE6 | 9-115 | None |
| A0A2G2MSN0 | 22-130 | None |
| A0A2T5G036 | 115-223 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.