DPCstruct | MC18241
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 66 ± 3 aa |
| Standard deviation of domain lengths | 3.35 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 77.53 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 53.05 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N1PI29 | 1-68 | MKIKELKRTVNVSWSPAEQYPIMLAAGTAAQQVDASFSSNSSLELYSLNLEEPGMDLELKASLQTQHK |
| A0A3Q1LLC9 | 1-68 | MKIKDLERTANVAWSPANQNPIYLAAGTAAQQLDASFNTNAALEIYSLNLADPGPDMVLKSSAPTEHR |
| A0A3S1AFL0 | 1-68 | None |
| A0A061DW05 | 3-66 | None |
| A0A7J7UYH9 | 20-84 | None |
| A0A5N4DKS6 | 58-126 | None |
| A0A2I2Y5Z3 | 1-59 | None |
| A0A663LUX4 | 1-68 | None |
| A0A060XW22 | 1-68 | None |
| A0A3B3ZZA0 | 1-59 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.