DPCstruct | MC18240
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 18 aa |
| Standard deviation of domain lengths | 18.29 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 83.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 32.51 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| H3HAJ1 | 121-222 | WYDETLEAMGGDSHENMADLERQACMFENQCLGGTEDYSEEFKAIWKVKEPRCKTIVDAIINGSDPINYDSWREDMEARFGCPLPTN… |
| A0A397EAJ9 | 49-133 | TLAGARGWSHDHLICQVETMVCLHHHECHGGCYDYSAAFKASFRPMGPPRCKVVVDRVKHGKVHIDVDNWRGVMAKFFPCDKNNT |
| A0A833TJI0 | 224-325 | None |
| A0A3R6VMN7 | 246-360 | None |
| A0A024UQH4 | 222-342 | None |
| A0A485K6I0 | 187-286 | None |
| A0A0W8CT97 | 178-295 | None |
| A0A397DWE5 | 56-182 | None |
| A0A0W8DM46 | 156-218 | None |
| A0A485LB67 | 536-614 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.