DPCstruct | MC1824
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 154 ± 19 aa |
| Standard deviation of domain lengths | 19.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 73.47 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 90.93 |
| Assigned Pfam label(s) | PF14784- CL0020 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G1S7T4 | 91-224 | WLVFSQSPAQKEIIEGLAETSTLYVEEGGTAYVGRDYLSYFVLKYYVDDETREKKLRPPAPDSNYNTLKVKFYGKPVKEKYADALDK… |
| A0A183J4Q4 | 4-145 | RHPSNQPIYVDGPFRVWVNDQSFFHFVLRASPKEHVHFETFRSDEPPTADEWANWQTKYTAEFPESRREVIQLPTIHEQTDGTILAI… |
| A0A2P2I4Q4 | 148-298 | None |
| A0A2G9USU6 | 60-198 | None |
| A0A6P8ZW98 | 259-420 | None |
| A0A7J7TA18 | 94-251 | None |
| T2M6R8 | 256-386 | None |
| A0A3S1BRD8 | 344-502 | None |
| A0A834PBM1 | 212-346 | None |
| A0A1I8IX33 | 364-574 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.