DPCstruct | MC18238
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 128 ± 26 aa |
| Standard deviation of domain lengths | 26.32 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 75.46 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 33.36 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| W2PUU4 | 96-234 | GQSTTKVARAKKKGSQSLAAIWFEWFTAEPRVYASPVVKKTTLYEFRHITGYMMLFLPTGFALDVASPAYKDEVLALGDKARKSALE… |
| A0A6G0LX77 | 10-136 | AASKTAAATWFEWYTKTPRIWEVCDDRQYKYQPKQIVAYMKLFHPLGFSLDPTTREYADRVMQAGNTAQKNMHEFLQARGIKRKFGS… |
| G4ZDT1 | 126-267 | None |
| A0A2P4YT49 | 5-216 | None |
| K3WYX6 | 21-144 | None |
| F0WNH4 | 28-158 | None |
| A0A225WJF7 | 432-567 | None |
| A0A6A4C2P1 | 410-545 | None |
| W2P544 | 1-105 | None |
| A0A2P4YTU5 | 4-110 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.