DPCstruct | MC18237
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 71 ± 5 aa |
| Standard deviation of domain lengths | 5.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.69 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 42.87 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A833W766 | 147-214 | LHSRVHSDVIEYERRRKRNRGGRYMLEYLVAYMTVAGGPEEKQWLGVDVFKALLDAGKLEDEIGGDGE |
| A0A6G0LVB6 | 31-105 | QGRVRRQGDERVELRRRRRRNAAGQYVLELEVQDVRPAGARRKMEGAKRWISIRQYDQLLQDGRAVEDPRFGEVV |
| G4ZZ12 | 46-113 | None |
| A0A6A3QZU6 | 247-319 | None |
| A0A6A3MPK7 | 354-414 | None |
| A0A6A3UZP5 | 78-140 | None |
| A0A833T480 | 203-268 | None |
| A0A6A3HUC6 | 44-111 | None |
| A0A6A3G7N3 | 1-77 | None |
| A0A6A3HL09 | 105-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.