DPCstruct | MC18235
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 122 ± 10 aa |
| Standard deviation of domain lengths | 10.38 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.12 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 38.39 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A4FC30 | 81-210 | FRSPSGYRFVVSDNFYTRHTFAKAILAFTDGEVRTTGTVRLNVIGEWNKPAVEDSVRRVAEAARGEWEFVTVVDLEPGTKKKEVDHD… |
| A0A6G0LLX0 | 7-135 | QQLTAPSGKRVVVMDSYYTRHAFAKHALSMSAGETRIIGTCRLNYVDCLPRPAVEAAILALKDADRGAWKLVAAVDTVSNMKAAEKA… |
| W3A437 | 409-533 | None |
| A0A662Y5G0 | 5-140 | None |
| A0A225WQ27 | 156-276 | None |
| A0A225WLJ2 | 183-301 | None |
| A0A225VMR1 | 86-199 | None |
| A0A2P4XUN5 | 2-127 | None |
| V9EDK9 | 1-123 | None |
| W2R0N4 | 1-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.