DPCstruct | MC18231
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 63 ± 6 aa |
| Standard deviation of domain lengths | 5.74 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 78.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.86 |
| Mean intra-cluster sequence similarity (%) | 75.39 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6G0JS04 | 1-74 | MVGRILTPLKDGDIERLHSSLRSSARTLHNAITSVRQAAEWGMGSVQKVYSRLNLPLLRPGASGASPEQHVSPS |
| H3GVX1 | 72-128 | MVGRILTPLKDGDLERIQPELRSAARTLHNAITSVRQAAEWGMGSVQKVFSRLNLPL |
| A0A6A3KI62 | 17-72 | None |
| A0A329SXX6 | 16-75 | None |
| A0A6G0JZ03 | 28-90 | None |
| A0A329SWG0 | 29-88 | None |
| W2N4U7 | 72-128 | None |
| W2NIS1 | 1-67 | None |
| A0A6A3K6M2 | 1-61 | None |
| A0A6A3MWJ0 | 27-98 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.