DPCstruct | MC18227
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 190 ± 22 aa |
| Standard deviation of domain lengths | 22.43 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 81.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 21.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A316QCB9 | 33-208 | AIGGGVWLVLFILQGVGLYTMAKKRDMKNKWLAFVPFASVWYMGKLAGTCDVFGRKMKRSGLYVMLAQIIATLVCAAAIAVEILLFT… |
| A0A351H763 | 1-219 | MLNFHFKSDLSAIDRETLFGIIFAVVLYTAIMAAICLALYILRAIGIYKMSKTAGVEYPWLSFIPVANSFTLGRLAEKYHKNPIEKP… |
| A0A1G8PRX4 | 49-205 | None |
| A0A374DLK7 | 1-159 | None |
| A0A3R8L3K3 | 10-224 | None |
| F7KPV5 | 9-202 | None |
| R6D3H6 | 1-193 | None |
| A0A317RIE8 | 7-188 | None |
| A0A3B8P3I8 | 2-218 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.