DPCstruct | MC18225
Metacluster Properties and Pfam Annotations
| Number of structural domains | 28 |
|---|---|
| Mean domain length (aa) | 131 ± 11 aa |
| Standard deviation of domain lengths | 11.06 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 83.33 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.74 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1J8QJB6 | 8-133 | SRNDTKLQRLRTALTHLPDCIPLDNSKYQFEHFTPDPEKVEEYGSAEAAVNNALEVTFAPKGRKNESAPCPFEFQGRGPGLVAVVDV… |
| M5CDT3 | 3-138 | LPANVSCNLERLCELCSLLPSKSPDNSLLYPFNLYIPDEEWIENTRSLQGALNHILEVAFSLWATVDNAPIKLKSHSPDLLAVVDVL… |
| A0A4Y9ZFH0 | 4-133 | None |
| A0A4Y7QHC1 | 11-126 | None |
| A0A166JHH7 | 14-186 | None |
| A0A4Z0A0S0 | 3-125 | None |
| A0A5C2RQI1 | 1-139 | None |
| A0A4Y9YA11 | 9-137 | None |
| A0A4Y9YMY3 | 36-167 | None |
| A0A0D0BU49 | 1-134 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.