DPCstruct | MC18224
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 349 ± 59 aa |
| Standard deviation of domain lengths | 59.12 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 71.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.59 |
| Mean intra-cluster sequence similarity (%) | 16.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09531 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N7KFW1 | 3-252 | ILETLELSDPRSLMQYLAYQDLCAVSECNLEPWRRAAFFEESGETYKRIVTACLKPLEEFTSKIAEALEGFSSEKPELLSQQFKLAA… |
| M5CDB9 | 3-341 | VLQFATLVVWDVAGEWFEINASQVIHLSQFKEDPNAVLIAGLQSQDPYYKYFAFAELANVVSTRPPRRVALFSDLKANPTAWEQVCR… |
| A0A2P4VB33 | 621-932 | None |
| A0A2S7P7L6 | 289-639 | None |
| M3JTS8 | 1-420 | None |
| A0A1A6HDN4 | 194-526 | None |
| A0A0B2VNE3 | 35-278 | None |
| A0A376B8I6 | 5-414 | None |
| A0A1B7TCN1 | 296-665 | None |
| A0A6A4V2K7 | 5-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.