DPCstruct | MC18221
Metacluster Properties and Pfam Annotations
| Number of structural domains | 55 |
|---|---|
| Mean domain length (aa) | 104 ± 19 aa |
| Standard deviation of domain lengths | 18.60 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 77.10 |
| Mean fraction of residues predicted as intrinsically disordered | 0.49 |
| Mean length-normalized TM-Score | 0.50 |
| Mean intra-cluster local Distance Difference Test score | 0.70 |
| Mean intra-cluster sequence similarity (%) | 22.55 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09579 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A428WDX3 | 6-75 | IFGDPYETPDGTTVIPVHRPVGVFAVRDGQAKWEPAVDATRVALLAVGIGLVAATLAGLAMVHRPPWPDL |
| A0A429HSD9 | 14-126 | ADHVSAVLLEQLADKLGRRAPGTVVFGEPIVSQDITVIPVARIGFGFGGNTGQQAGEDGVVGGGVEAKPLGFIEIKEGKAVYKPIRD… |
| A0A2N2PXW2 | 42-142 | None |
| A0A7I7USF6 | 47-116 | None |
| A0A3A0AZQ7 | 20-142 | None |
| A0A4V2WB09 | 7-131 | None |
| A0A382SUA1 | 5-122 | None |
| A0A1I6E5X3 | 4-94 | None |
| A0A521FV77 | 8-97 | None |
| A0A4P8RJ08 | 4-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.