DPCstruct | MC18220
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 57 ± 3 aa |
| Standard deviation of domain lengths | 3.45 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 64.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A429HRX3 | 2-57 | EKAIDNDMAAYAHSLRANGVPVLQIASKLVINSGMNKGEHPSVATAYRVLAEDDVS |
| A0A1L9E2P7 | 26-82 | GAGVTDDSMLSMALHLRAQEMSLRDIAKRLVITTGAKKGQHPSPATVMRMLREHDEQ |
| A0A7W9NS25 | 159-215 | None |
| A0A0N1JWZ1 | 236-288 | None |
| A0A2D3U5K8 | 307-358 | None |
| A0A1S6RIK2 | 69-125 | None |
| A0A1S6RBK9 | 83-139 | None |
| A0A495H3X0 | 235-297 | None |
| A0A1L7F8Q9 | 1-53 | None |
| A0A7W8F0G7 | 242-298 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.