DPCstruct | MC1822
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 124 ± 11 aa |
| Standard deviation of domain lengths | 11.08 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 81.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 30.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3P7Q1C0 | 155-283 | DIRGGYSKPSVFDTLFWTILVSPITFCKYIIWNCEWIIKYWIKKEDYDIEAKFYLIRKYMGISEEQFNCLEDEERLCFLDAELWVKA… |
| A0A183J1T6 | 21-143 | FRGGYEKPSVKDTLFVQILTFPYYACTYCWWLCVWTYRFKLKGEEYGLEDKYYLIGKNLGMSEKQFSVKHEKQEFLDQELWIKDKFL… |
| F1L043 | 278-406 | None |
| A0A212EUD6 | 116-236 | None |
| A0A1A8VU12 | 200-324 | None |
| A0A0H5RK21 | 203-311 | None |
| A0A2P5WVE8 | 143-278 | None |
| A0A1V9Z6K8 | 555-697 | None |
| G0PNT1 | 46-167 | None |
| Q7RN54 | 10-119 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.