DPCstruct | MC18218
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 132 ± 8 aa |
| Standard deviation of domain lengths | 8.21 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 86.25 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.90 |
| Mean intra-cluster sequence similarity (%) | 51.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF03223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3R7C4L8 | 614-747 | EEQRHKLEDNLTINGLNPATFLVKFQWDYAKYPVKQTLSSLYAIISEQLSKIDADLKVKSTAYNAVKGNLQNLERKQTGSLLTRDLG… |
| Q4SZP1 | 1-134 | MEGSRDKVLENTLVNGVDLLGYATRFEWDKAKYPTTNPVTCLKDLINKDVLQVAKELKSRSAAYNSGKASLQSLERKLDGTLQNRSL… |
| A0A060ZG28 | 1-143 | None |
| A0A7J7J3U4 | 42-157 | None |
| A0A6J3J6J7 | 12-130 | None |
| A0A6P6DER9 | 84-217 | None |
| A0A6A6LMZ2 | 168-310 | None |
| A0A6J0WRX6 | 79-213 | None |
| A0A812DLF2 | 157-273 | None |
| A0A0N4TMH4 | 137-270 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.