DPCstruct | MC18214
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 107 ± 11 aa |
| Standard deviation of domain lengths | 10.60 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 80.05 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 40.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q4S863 | 14-138 | MSVSGLKAELKFLESIFDPNHERFRIIDWKPDELSCQFNVTGDKLLIIHCNITESYPSTPPIWFVDSDDPSLAQVLERLDDVRRGST… |
| A0A0B6ZX54 | 4-103 | LARLKEDIRVLETAFPRVHNRFQVLTATVDELTCRFIGRNGEKFDVQANITETYPQTAPIWFSDSEDASTLGIVGELANTKPEQFNI… |
| A0A3Q0KDU0 | 4-102 | None |
| A0A310S6R1 | 4-105 | None |
| A0A132AIM4 | 1-128 | None |
| A0A3Q7W4Q5 | 1-96 | None |
| A0A6I8R5V5 | 3-104 | None |
| A0A3Q0JJP6 | 4-105 | None |
| A0A1X7U203 | 5-110 | None |
| A0A2A2LYP0 | 156-262 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.