DPCstruct | MC18212
Metacluster Properties and Pfam Annotations
| Number of structural domains | 417 |
|---|---|
| Mean domain length (aa) | 221 ± 51 aa |
| Standard deviation of domain lengths | 51.08 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.48 |
| Mean intra-cluster sequence similarity (%) | 17.45 |
| Pfam Score | 87.95 |
| Assigned Pfam label(s) | CL0125- CL0257- CL0099- PF00696- CL0039 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453GEG9 | 1-213 | MKFGGSSVSSAARMKEVAGLIQAFPEERPVVVLSAMGKTTNLLLLAGEKAVGCGVTRVSEIEEWNMLRDLHIKTVDELGLPRSVIHA… |
| U5RT38 | 20-241 | KNVAKTVVSRVENGDSLVVVVSAMGDTTDDLIALSKKITDTPDKRELDALLSTGEMMSCALLAMAIKDLGYDAVSYTAYQIGIKTSG… |
| A0A2N9IBZ4 | 513-751 | None |
| A0A0B8PDK9 | 61-296 | None |
| I1CK30 | 2-176 | None |
| W7C657 | 128-411 | None |
| A0A520R111 | 26-198 | None |
| A0A7J6L3W9 | 24-306 | None |
| A0A068UWC2 | 123-289 | None |
| A0A7X7KVH2 | 15-159 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.