DPCstruct | MC18211
Metacluster Properties and Pfam Annotations
| Number of structural domains | 40 |
|---|---|
| Mean domain length (aa) | 134 ± 20 aa |
| Standard deviation of domain lengths | 20.23 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 80.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.79 |
| Mean intra-cluster sequence similarity (%) | 38.52 |
| Pfam Score | 92.59 |
| Assigned Pfam label(s) | PF03172- PF00439 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A287D6N8 | 7-99 | EEQFLHEHLFRHFKENKVEIASAITKLFPFLMSLRDRAFISEQMFDHLQEACRNLVPVNAVVYTVLSELERTFSLSLLDELFSRTNL… |
| A0A6I9LTD0 | 1-131 | MSTEQQDPEKTPFELTFLYFKTQKVKISYAIQRPFPFLEILRDTELITEKMYDDFTDSCMNRVPVKRVVYRALEVLEKRFDLEVLRV… |
| A0A7J8JNL8 | 24-152 | None |
| A0A2D4NG23 | 1-129 | None |
| A0A6P7DQY2 | 63-213 | None |
| M3W5K8 | 4-155 | None |
| A0A670IJJ5 | 328-455 | None |
| I3M5T7 | 9-117 | None |
| A0A7J8JLQ4 | 1-175 | None |
| A0A3B5AFE7 | 5-154 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.