DPCstruct | MC18210
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 115 ± 12 aa |
| Standard deviation of domain lengths | 11.72 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 89.57 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.81 |
| Mean intra-cluster sequence similarity (%) | 20.29 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF10552 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6S6YE57 | 43-164 | KKETIEELSFLKNNDKKKSEILNEQNIKINEHDTRITKQEKIISVIGFGPNSKKGKILRGICCSRVYSLLGDKSSVNFIVWQSYFFK… |
| A0A0R2I9B1 | 19-151 | VSKNTEPVNEKLPKVFKEIGHRLRNTDEKLIDHDSRLKKLEGQESINAIEGGRLDKTIVKRATNIVGGYQSNAYQDGHTYAMISREL… |
| A0A0A0HVY9 | 71-181 | None |
| A0A1T2XCN0 | 106-216 | None |
| A0A1S2FCW3 | 5-96 | None |
| A0A1T2XC70 | 1-124 | None |
| G6FCD4 | 3-108 | None |
| A0A2P1TF69 | 3-100 | None |
| A0A6L5MJE4 | 173-289 | None |
| A0A2C9X341 | 1-91 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.