DPCstruct | MC1821
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 291 ± 54 aa |
| Standard deviation of domain lengths | 54.34 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 72.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.53 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 26.57 |
| Pfam Score | 76.07 |
| Assigned Pfam label(s) | PF04494- CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A016T4A1 | 2-237 | SKSSLKQLEIPLARTPTIKNIVKEHITLEASDVVSKLRSSIECQMGGVLGQVSKNEKRHKMHYGVLKDDVSQAIEKKKTRGKELKDS… |
| A0A183IXV3 | 2-268 | ERFGQLQEYYWQEYVEQLSALHHPEQIDTSDLALALSKNNFVVRISRESNSELRMIFAGLSLVPRIVKSKILLELCDSPARSKEIVE… |
| A0A3Q0KRC6 | 51-404 | None |
| A0A0P0X3L9 | 1-253 | None |
| A0A3P3YGN4 | 88-459 | None |
| A0A7J7JHT5 | 3-195 | None |
| B4J1M2 | 304-538 | None |
| A0A7S0TBY4 | 1-288 | None |
| A0A0R3Q8F0 | 3-327 | None |
| G3QRR7 | 213-511 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.