DPCstruct | MC18207
Metacluster Properties and Pfam Annotations
| Number of structural domains | 26 |
|---|---|
| Mean domain length (aa) | 117 ± 11 aa |
| Standard deviation of domain lengths | 11.00 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.22 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 38.30 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0105 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9AWD6 | 9-112 | LDFVAKFNAGEEFPPCTVEVYKLLEKVDYPRNQKNEIMAVIHPHLQDRDWQPLNPGDPMFLTLEGKTVAYDGEVTVFPTFVNEAAYY… |
| A0A2N6MXJ4 | 3-105 | LDYIQNNNQGIKQPIYNSFFIYKQVETIDYPRDEQGELKAMVAPQLKDYEPLYPNSPMFLGFDGQEITYQGNSTCYPVFVAEAAYLE… |
| A0A6P3VQG8 | 290-405 | None |
| A0A1Q9E3N7 | 548-664 | None |
| A0A498LUU9 | 50-167 | None |
| A0A7S1Z045 | 9-121 | None |
| A0A553MMI5 | 472-580 | None |
| A0A836CZJ5 | 325-439 | None |
| A0A673CX20 | 65-182 | None |
| A0A6B0S2R6 | 608-721 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.