DPCstruct | MC18206
Metacluster Properties and Pfam Annotations
| Number of structural domains | 38 |
|---|---|
| Mean domain length (aa) | 81 ± 7 aa |
| Standard deviation of domain lengths | 7.34 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 83.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.46 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 38.56 |
| Pfam Score | 90.15 |
| Assigned Pfam label(s) | PF03449- CL0487- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A7KZ63 | 273-350 | SDEVKNYITPGGYRRLQEELARLWKVERPPIVTTVAWAAGNGDRSENGDYIYGKRKLREIDRRMRYLSKSLDRAVVVD |
| A0A2D4SKH2 | 74-147 | MKKITKKGYNAITAEIDERWNVERPIVVEEVYQAALLGDRSENAAYIYGKQRLRKIDSRIRYLKKKISDVKIID |
| A0A7V0T6C2 | 387-460 | None |
| A0A1A9VJX6 | 667-739 | None |
| A0A2V7WRT6 | 1-106 | None |
| A0A1J4RL78 | 24-100 | None |
| A0A7E4S1H3 | 211-289 | None |
| A0A399YZ95 | 6-79 | None |
| A0A410FSJ0 | 4-81 | None |
| A0A816QR06 | 1-79 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.