DPCstruct | MC18203
Metacluster Properties and Pfam Annotations
| Number of structural domains | 36 |
|---|---|
| Mean domain length (aa) | 227 ± 60 aa |
| Standard deviation of domain lengths | 59.67 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 87.14 |
| Mean fraction of residues predicted as intrinsically disordered | 0.29 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.46 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2G2P2W0 | 127-469 | QETSLNENDVINKVGYKVFEDKRVYKYIEEDVHHTKGLLCIDCHSSHEVMGNGKKYAHEEQAVSLQCSDCHFKEEPRTIPYDSLDIE… |
| A0A3B1E6K6 | 9-202 | MTLSNNWEEKINCKSCHKNISKTNHKKYHKKISCSACHSSWNISSYELNVFRDDTNNYAQWKRLKVQDDIYLEQFLTKALKNKNTTK… |
| A0A7C2A174 | 304-437 | None |
| A0A3M1TNX1 | 744-902 | None |
| A0A3A4NMT2 | 300-554 | None |
| A0A256WDV7 | 1-296 | None |
| A0A660VXN2 | 288-596 | None |
| A0A1G0B1J1 | 14-193 | None |
| A0A357ZJ03 | 78-286 | None |
| A0A2E7Y493 | 346-604 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.