DPCstruct | MC18201
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 136 ± 14 aa |
| Standard deviation of domain lengths | 13.99 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 26.74 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3S6EWW8 | 1-128 | MATLKDLSNQLQQIKKQIPFAAAQALTSVARQIAAAQKVGMQRNLDNPTPFTVNSVGSFGARKDRLQARVFVRDIAASYLEPFEFGG… |
| V6MKV9 | 1-120 | MANLTDLTNQLNTIRKQILFTAALALTIATRKIENVQKIALQCNLESLLLFTIKSIKSRGARKNNLKAKVFVMNIAIGYLMPFEIRG… |
| A0A846UAH4 | 1-141 | None |
| A0A447IRD9 | 1-131 | None |
| A0A2X0QVL2 | 1-141 | None |
| A0A1S1NMJ3 | 1-144 | None |
| A0A494XGF3 | 9-154 | None |
| A0A7L6A822 | 1-159 | None |
| A0A1E3ZLC2 | 2-111 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.