DPCstruct | MC1820
Metacluster Properties and Pfam Annotations
| Number of structural domains | 65 |
|---|---|
| Mean domain length (aa) | 110 ± 20 aa |
| Standard deviation of domain lengths | 20.37 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 81.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 30.71 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0015 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A226P4F9 | 142-262 | VVLSCLAGILASTSHTPSFMLILRSIQPEDKSFAVGIQFMLLRVLAWMPGPVLYGSAIDTTCILWEKKCDRKAACRYYDNNLFRQRY… |
| A0A183IWE9 | 5-124 | LFIGNIFFMTTVMVVLRSVCIEQRSLALSFATFLTNIIGFIPSPVIFGSIIDTACVAWYSLCQENGNCLLYDNAAFRIKYHVGNAAF… |
| A0A6V7W3S5 | 28-150 | None |
| K7H8R7 | 131-250 | None |
| A0A8B6D676 | 17-155 | None |
| A0A158QFU0 | 102-228 | None |
| A0A835TNL6 | 49-168 | None |
| A0A6I9PG10 | 2-81 | None |
| A0A816V4Q8 | 5-99 | None |
| A0A2D4FVT0 | 2-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.