DPCstruct | MC182
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 282 ± 24 aa |
| Standard deviation of domain lengths | 23.94 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 81.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 23.56 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6C0KQK2 | 1-278 | MSEEKQKLTPIEAINEFYRLKDKYETSYYDKYVKQILKSKKSKKEKRVEYSRLPKHECINCKRNVGTIFTITYDFNDLTRKFISKCG… |
| A0A6C0BW71 | 2-262 | ASNNTTLYKAMDQYFIYKGNIEQKRTLAKKKIINNDELDKDAKTALIATLSQKCINCKRDVGTTFSENDRTFKVVCGDVSKPCNLNI… |
| A0A6C0C5X4 | 15-317 | None |
| A0A6C0CI86 | 20-296 | None |
| A0A6C0I3L7 | 289-566 | None |
| A0A6C0DHM7 | 1-289 | None |
| A0A6C0M3L3 | 2-268 | None |
| A0A6C0C4W7 | 41-335 | None |
| A0A6C0IRF9 | 1-232 | None |
| A0A6C0KV48 | 22-348 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.