DPCstruct | MC18199
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.10 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 76.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.82 |
| Mean intra-cluster sequence similarity (%) | 46.04 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF12295 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7S2SXY0 | 414-501 | KGFIVQLLARLVAKKIWEDLPQWQGFLMCASKLGAYPVLLQLPTPHLQAAIQRMPDLKLKLNEFVQQDRVTASKLPRTTLQVLGVQQY |
| A0A0D2TTY4 | 1-115 | MEILSKLVSKQVWRMPKLWVGFLKSVAQTQPHSFPVLLQLPPPQLESALNKYGSLRSSLAAYASQPTRKGSLPRSTLAVLHLANESH… |
| A0A397YD29 | 1-107 | None |
| A0A7S2B7D7 | 37-128 | None |
| A0A7J7MSM8 | 1010-1126 | None |
| A0A672K8Y2 | 567-678 | None |
| A0A7C8YK99 | 318-395 | None |
| A0A0D3BIG1 | 343-449 | None |
| A0A819VZ88 | 181-278 | None |
| A0A438F8H3 | 111-204 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.