DPCstruct | MC18197
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 53 ± 3 aa |
| Standard deviation of domain lengths | 2.58 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 86.52 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.93 |
| Mean intra-cluster sequence similarity (%) | 94.83 |
| Pfam Score | 87.50 |
| Assigned Pfam label(s) | CL0020- PF00223 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0D2SUK9 | 1-58 | MLTQSEGNYAKALQNYYEAMRLKIDPYDRSYILYNISLIHTSNGEHTKALEYYFRALE |
| A0A453JFQ9 | 43-96 | MLAQSEGNYAEALQNYYEATRVEIDPYDRSYILYNIGLIHTSNREHTKALEYYF |
| A0A452YKP0 | 1-54 | None |
| A0A7J7L6X1 | 1-54 | None |
| A0A5D2VCJ0 | 1-54 | None |
| A0A4D6NPI7 | 400-451 | None |
| A0A251UVK9 | 40-92 | None |
| A0A1W6GX21 | 1-54 | None |
| A0A0B2QVF1 | 1-54 | None |
| A0A453M4Z6 | 2-48 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.