DPCstruct | MC18196
Metacluster Properties and Pfam Annotations
| Number of structural domains | 49 |
|---|---|
| Mean domain length (aa) | 94 ± 15 aa |
| Standard deviation of domain lengths | 15.23 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 86.38 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 34.13 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF08899 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5VB71 | 11-89 | FIQLIKTFESTAWIQLGKIKNPNTDRLERNLMQAQYSIDMLDMLKAKTEGNLTEEESRLLNEIITNLKLNFVEEMEKEK |
| A0A2H9NUP6 | 9-103 | ENPQSHEAYEAEFVQHLLSLQTTGFMFLGKIQNPLTGTSEKNLAAAQKVIDTLLMLKAKTAGNLSVSEESMLTTIITQLELNFVDEA… |
| E8V5K7 | 66-204 | None |
| A0A523UPR7 | 1-88 | None |
| A0A1G1HWT5 | 2-74 | None |
| A0A2S8FFG1 | 54-139 | None |
| A0A520XCH1 | 99-186 | None |
| B4D5S2 | 11-107 | None |
| A0A2H0LS94 | 38-128 | None |
| A0A523WEK7 | 10-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.