DPCstruct | MC18181
Metacluster Properties and Pfam Annotations
| Number of structural domains | 176 |
|---|---|
| Mean domain length (aa) | 283 ± 44 aa |
| Standard deviation of domain lengths | 44.36 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 83.78 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.41 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 16.06 |
| Pfam Score | 95.16 |
| Assigned Pfam label(s) | CL0023- PF06527- CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2N1C3E4 | 6-299 | INHQLLLRPKVNRSESFQSYLIRLARANGYVYTAFSSEITAKSKPHRSMKLADRKEIQTLFKSISDPNVSELTDIWECAHYHKQQFD… |
| A0A7Y0HNP3 | 4-271 | KLTVRLEIFRDESISSYIFRVSKENGLSYLAFWNMIKSSTKDYAQFSEINILDIAPLGHIDRDSYEERTGYSSESLINNSFYKVLEK… |
| A0A3N1IU36 | 10-353 | None |
| A0A420D6S0 | 8-291 | None |
| A0A5C6VAN9 | 2-293 | None |
| A0A1I5L4E5 | 19-245 | None |
| A0A2A3YHW8 | 15-323 | None |
| A0A2N3VRF4 | 260-584 | None |
| A0A4R7QN78 | 547-928 | None |
| A0A4Q9KE46 | 111-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.