DPCstruct | MC1818
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 75 ± 4 aa |
| Standard deviation of domain lengths | 3.66 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 89.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.95 |
| Mean intra-cluster sequence similarity (%) | 40.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07774 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| Q2H523 | 150-232 | ITHERDVLGVEKIITAPAIVESTSLVFAYGIDVFGTRVAPSFLFDILGKGFNKVALVGTVLALLAGVLMLAPVVRRKQINLRW |
| A0A183ITD3 | 1-72 | MRTFPSGLESTSLLFVAGLDLFFNRVSPSGTFDILKEDFDHWFISFVLLSLLLASLLSKRLAKQKDLKQSWR |
| Q1WMU7 | 70-142 | None |
| A0A1S8WZW8 | 291-364 | None |
| A0A183K9X9 | 375-448 | None |
| A0A0D8Y9K6 | 30-101 | None |
| A0A7S2UA25 | 84-157 | None |
| A0A0P0WJT6 | 661-734 | None |
| A0A6U4TBM4 | 60-133 | None |
| A0A812S558 | 328-401 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.