DPCstruct | MC1817
Metacluster Properties and Pfam Annotations
| Number of structural domains | 27 |
|---|---|
| Mean domain length (aa) | 86 ± 12 aa |
| Standard deviation of domain lengths | 12.41 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 82.06 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 41.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0003 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A183IQR2 | 4-88 | WQNFLEAAGLQKPIALQYGTLFAENRIRTNMLPDLTKEVLKEMGIRAIGDIMLILNHCKQQYLSQVVAWLGVLVIVHVLETVPLF |
| A0A7J7JLQ6 | 10-74 | WLQFLLAAGIPASQAASYAVSFVENRIEKDMLTDLDKDYLKELGITVLGDIIAILKHAKKVSSQM |
| A0A183BFU5 | 4-89 | None |
| A0A182E7Y0 | 122-220 | None |
| A0A4W3HU96 | 37-131 | None |
| A0A3P7C474 | 4-90 | None |
| A0A6J0CB16 | 55-152 | None |
| A0A183FBT8 | 1-85 | None |
| E4XVR0 | 20-105 | None |
| A0A6G0YN15 | 565-630 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.