DPCstruct | MC18169
Metacluster Properties and Pfam Annotations
| Number of structural domains | 31 |
|---|---|
| Mean domain length (aa) | 132 ± 28 aa |
| Standard deviation of domain lengths | 28.41 |
| Length coefficient of variation | 0.22 |
| Mean AlphaFold2 pLDDT confidence score | 65.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.47 |
| Mean length-normalized TM-Score | 0.51 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 39.76 |
| Pfam Score | 87.62 |
| Assigned Pfam label(s) | PF12496- CL0512 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1S3MUN4 | 5-101 | WKDDLPKPKTTEVLQKGVESVQVYSASEEREEGRRWRVFRIGDQEHKVDMKAIEPYKRVINHGGYYGDGLNAIIVFAVCYMPESNQP… |
| A0A671P298 | 3-126 | KRRTLIAPDINLSLDKSEGSLLSDDFLETPDDLDINVDDIDTAKGPGGDGGDGTGRLWRTVIIGDQEHRIDMQVIRPYLRVVTHGGY… |
| A0A1S3MUG9 | 29-129 | None |
| A0A7R9Q7G7 | 261-385 | None |
| A0A3Q3FBX2 | 254-360 | None |
| H3AUD5 | 66-168 | None |
| A0A7R9KSY0 | 705-829 | None |
| A0A3P4S320 | 26-215 | None |
| A0A2I4CVI9 | 33-178 | None |
| A0A131Y3E5 | 912-1023 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.