DPCstruct | MC18168
Metacluster Properties and Pfam Annotations
| Number of structural domains | 489 |
|---|---|
| Mean domain length (aa) | 125 ± 19 aa |
| Standard deviation of domain lengths | 18.56 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 85.02 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 31.62 |
| Pfam Score | 99.28 |
| Assigned Pfam label(s) | PF01412- CL0154- CL0110- CL0080- CL0192 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A671NUV5 | 6-126 | AEALSNYEVAERIWAEPSNQMCADCSDAKPEWAAINLAVVFCKRCAGEHRGLGPSISKVRSLKMDKKVWSEDLIQVCLVYVRVLYEA… |
| A0A453BA28 | 4-72 | QILEGLLRLPENRECADCKSKGPRWASVNIGIFVCMQCSGIHRSLGVHISKVRSATLDTWLPEQVAFIQ |
| A0A0B0P9A8 | 1-130 | None |
| A0A1V2LK23 | 384-525 | None |
| F4Q4Y9 | 3-138 | None |
| A0A4Z2HJI2 | 2-110 | None |
| M2Q6E3 | 918-1036 | None |
| Q5KAL5 | 1038-1172 | None |
| A0A7M5VD33 | 622-744 | None |
| A0A504X3Z6 | 5-149 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.