DPCstruct | MC18165
Metacluster Properties and Pfam Annotations
| Number of structural domains | 204 |
|---|---|
| Mean domain length (aa) | 162 ± 35 aa |
| Standard deviation of domain lengths | 34.70 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 91.56 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.04 |
| Pfam Score | 97.67 |
| Assigned Pfam label(s) | CL0193- CL0020- PF07715 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7C5S415 | 324-467 | LVFDPHIPSLIMGAGNTPQEIRMSGVRVNKFEVRRGAMADLSNDFPIFRYADILLMKAEALIRQGKNGDEYVNQIRNRAGLGNWTNV… |
| A0A7T9Q4D5 | 42-194 | DADTEIPFNVKQKHANSFQSGDHFYLLRLADIILLKAEAQNALGNTSGAINTINVIRHRAGLSDLSGVSSSALKAIILNERRLELAF… |
| A0A2N2ARF6 | 235-341 | None |
| A0A350YXS9 | 28-191 | None |
| A0A258E9C6 | 99-254 | None |
| A0A3C0ZB86 | 37-208 | None |
| A0A3C0RW96 | 125-292 | None |
| A0A7X7BZF7 | 81-249 | None |
| W4PKI5 | 13-139 | None |
| A0A1G6PHD6 | 570-695 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.