DPCstruct | MC18163
Metacluster Properties and Pfam Annotations
| Number of structural domains | 73 |
|---|---|
| Mean domain length (aa) | 121 ± 18 aa |
| Standard deviation of domain lengths | 17.62 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 88.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.85 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 36.19 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9MM35 | 123-264 | RNHLRLSTNISQFVLEVGSTPLSGNLDNAEGGFDAIMQAIVCRQHIKWEDLSRKIILFATDSIFHYAGDGKLGGIVQPNDGQCHLND… |
| V5GKB5 | 216-331 | LSFTGNIDQFIEMVVSSKTTANLDDLDGALDAILQILVCEQKIGWSKDSRKIILLPTDSLLHSAGDGLLVGAVLKPNGTCLLDDEGN… |
| A0A226F3H5 | 635-752 | None |
| A0A2I4CUM1 | 79-192 | None |
| A0A0C2JQA2 | 226-346 | None |
| A0A0C2J525 | 77-203 | None |
| A0A0C2J1T0 | 1-154 | None |
| A0A0C2INY4 | 12-140 | None |
| A0A0C2IMW7 | 16-140 | None |
| A0A6J1WXW4 | 94-198 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.