DPCstruct | MC18161
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 10.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 91.55 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.88 |
| Mean intra-cluster local Distance Difference Test score | 0.94 |
| Mean intra-cluster sequence similarity (%) | 56.25 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0145 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0N4WGN2 | 2-83 | QDLLYRRLRCLANYEAANKNLERARGRNKDIQKAETEQQEACKKFEDISALAKTELKDLKKRRVLAFKKNLADLADLEIKHA |
| V5FYZ3 | 2-105 | RDSQAARALLVRRLKCLANYENANRALEKARHKNKDIHAAEAAQSAACEQFEAISTQAKEELLDFKTRRLHAFRKSLIELAELEIKH… |
| A0A0C2J039 | 114-228 | None |
| A0A818CUI2 | 267-386 | None |
| A0A672SAI5 | 160-247 | None |
| A0A834BQ59 | 241-336 | None |
| A0A4Y7N5A1 | 303-408 | None |
| A0A6I9ZCN0 | 1-97 | None |
| A0A2W1BXB3 | 227-337 | None |
| A0A0N4UM36 | 67-171 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.