DPCstruct | MC1816
Metacluster Properties and Pfam Annotations
| Number of structural domains | 17 |
|---|---|
| Mean domain length (aa) | 91 ± 5 aa |
| Standard deviation of domain lengths | 4.69 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 85.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.83 |
| Mean intra-cluster sequence similarity (%) | 48.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0186 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6P9DK83 | 157-248 | DRKVSQPIEGHAAAFAEFKVEGNAKPSTLFCFAVRSPAGGKLHIIEVGQPAAGNQPFVKKAVDVFFPPEAQTDFPVAMQVNKLKKQV… |
| A0A183ILW4 | 1-87 | MQLYSIERKVSQPIEGHAACFLQFTLEGNPEPSNIFCFAVRNATAGKLHIIEVGSPPAGNQAHQKRAADVFFPPEAQNDFPVAMQVK |
| Q10161 | 181-264 | None |
| A0A0V0ZJ97 | 12-106 | None |
| F6HCN1 | 1-90 | None |
| A0A177T9R1 | 280-377 | None |
| J0WJA9 | 55-150 | None |
| A0A1Y3ENI4 | 1-101 | None |
| A0A835HHN1 | 71-158 | None |
| A0A165N288 | 108-203 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.