DPCstruct | MC18157
Metacluster Properties and Pfam Annotations
| Number of structural domains | 64 |
|---|---|
| Mean domain length (aa) | 175 ± 28 aa |
| Standard deviation of domain lengths | 28.15 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.48 |
| Mean intra-cluster local Distance Difference Test score | 0.53 |
| Mean intra-cluster sequence similarity (%) | 17.56 |
| Pfam Score | 33.33 |
| Assigned Pfam label(s) | CL0465- PF11140 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3A5H9S8 | 10-180 | LRDYARLQVRSGLLTEAEQLAEVAEAVAAEMPGIDAAILARAWIAAARQELLAEQATWPETTDVDRLRAAFVECQQHGVKVLAGAED… |
| A0A7J5BA63 | 25-209 | WFLEDVFQRILHGDIEDAYDAVELLEENIDEYLEDGEDFPEAAAFAFAEEPEEYTEALAEALWAAAYTTAQAWDEETTDTDRFVEAI… |
| A0A0T9RJT9 | 3-161 | None |
| A0A7W7MGT6 | 2-169 | None |
| F6FPM6 | 27-218 | None |
| A0A3Q9MXC8 | 5-197 | None |
| A0A511T189 | 193-396 | None |
| A0A840WIE7 | 9-226 | None |
| A0A1V1VC51 | 1-151 | None |
| A0A2K9ADX8 | 4-206 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.