DPCstruct | MC18155
Metacluster Properties and Pfam Annotations
| Number of structural domains | 23 |
|---|---|
| Mean domain length (aa) | 105 ± 14 aa |
| Standard deviation of domain lengths | 13.85 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 83.76 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.58 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 18.61 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1M4UHM6 | 7-118 | ISKKDNIIIYCVFGLPMLVLIGFVLYTAFSGPNREELRIQDDVSLNFNGRVDSMYFDERNHNGKYAVLNTNQIFPIYRNWERNIHIG… |
| F2IIG9 | 18-104 | SCANGHECDWEKAIYSESWDYEVATTYRDKKYNATYVIQTTTGKKIRFRPIQYIVSMAEPGDRIFKKRNSEYAFLIDGEGDSISSRI |
| A0A5M6CNV9 | 2-69 | None |
| A0A7Y7TQN1 | 5-82 | None |
| A0A2P8CFT8 | 14-129 | None |
| A0A3S9P9S3 | 1-116 | None |
| A0A0U4BLR6 | 4-100 | None |
| A0A6V6YM65 | 18-126 | None |
| A0A6A2EZ27 | 4-113 | None |
| A0A840EJQ9 | 6-129 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.