DPCstruct | MC18154
Metacluster Properties and Pfam Annotations
| Number of structural domains | 18 |
|---|---|
| Mean domain length (aa) | 96 ± 10 aa |
| Standard deviation of domain lengths | 9.56 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 74.63 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.79 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 51.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7W7AE46 | 3-95 | DKEKLLDEAEPLRFLFSHSALREGWDNPNVFQICALREMATERSRRQLLGHGLRLPVDNHALRRRDEGIARLTVIADTDYATFADEL… |
| T2SE71 | 2-96 | LSFDSDLRFIFSQWALQEGWDNPNVMTICKLAPSHSNITKLQQIGRGLRLAVNQRGERITKEHADFDCVNELVVIVPQVEGDFVGAI… |
| A0A1I6EL06 | 95-203 | None |
| A0A376CRD9 | 65-167 | None |
| A0A2I4NED9 | 2-86 | None |
| A0A3A9HGV7 | 334-428 | None |
| A0A5E5PXP2 | 49-139 | None |
| A0A2G6EZW5 | 12-101 | None |
| A0A1F8UUC3 | 356-445 | None |
| A0A1V4W4K6 | 68-155 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.