DPCstruct | MC18145
Metacluster Properties and Pfam Annotations
| Number of structural domains | 10 |
|---|---|
| Mean domain length (aa) | 249 ± 29 aa |
| Standard deviation of domain lengths | 28.90 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 78.94 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.69 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 19.84 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6J400 | 1-246 | MKEAESSKLQQISTSVWVPIPQCSSWYVGRDDLERIVLSMLRLPWTPFSYLIWKSNNGFWHSLLRESTGLLDHLPLLTARFDTVLER… |
| M2TA24 | 376-591 | YIRRVDLQSMALAALSVPVTRRHFLFNSERSDSVFSMLTVARFKQRKIVDAVKRTLPHWHLDKPATTLEQLLQDAEKVRVDGGHSRR… |
| A0A420MB11 | 295-594 | None |
| A0A4Q4XLF9 | 65-340 | None |
| A0A6A5TYW9 | 331-621 | None |
| A0A6A5T6L0 | 1-244 | None |
| A0A6A5JVV8 | 436-668 | None |
| A0A2I1CF20 | 355-593 | None |
| A0A1Y2X9W0 | 364-596 | None |
| A0A093VKX1 | 274-483 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.