DPCstruct | MC18144
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 339 ± 45 aa |
| Standard deviation of domain lengths | 44.67 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 71.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.38 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 19.65 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A179EXL0 | 56-413 | FPSPTSRSFFSSCLPCPNLPFRPSIDEMADEQHAVLMRHLKTAQQFTRPPKRLRQAFKATSEQRTYEREDTSRIFLEVGFRAWLAYF… |
| A0A6A6IRZ3 | 6-309 | TIDECVQLLASYLTNPWQRQRAPKGFDEALTTARSESTSTARVFLDAGFHAWLAYFLATEHEGRHHKGQSAKRKAITALQQFPIERQ… |
| A0A0G2H9M6 | 837-1172 | None |
| A6QYD3 | 1-322 | None |
| A0A428TNZ7 | 1-389 | None |
| A0A428SG43 | 3-389 | None |
| A0A0D2XBX0 | 319-618 | None |
| A0A4U6XQ82 | 1-241 | None |
| A0A0D2FI24 | 1-402 | None |
| A0A428RYX9 | 1-352 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.