DPCstruct | MC18142
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 262 ± 31 aa |
| Standard deviation of domain lengths | 31.38 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 22.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6A6INL8 | 2-266 | PRFRTVSSMDNAPPPPYSARSPSSSLSPNRVAHNPLMQLRRYIIEIMGFTFDADFSLLNEALGQTASTISTSPTNSILTPAEHAELL… |
| A0A6A6RR78 | 3-285 | RPSSNTSSAGIDTPPSSTSRESSPGPLADAATYNPQMQLRRYITEIMGFTFDVDFTLLNRALDPTVPISATSPTKSILTPHERAELL… |
| A0A7C8MQV2 | 30-343 | None |
| A0A6A5WEZ0 | 3-243 | None |
| A0A3M7MC73 | 27-287 | None |
| A0A6A5ZDW1 | 20-203 | None |
| A0A7C8MEP9 | 156-403 | None |
| A0A6A5ZBF6 | 67-358 | None |
| B2WPT8 | 2-238 | None |
| A0A177E103 | 43-319 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.