DPCstruct | MC18141
Metacluster Properties and Pfam Annotations
| Number of structural domains | 96 |
|---|---|
| Mean domain length (aa) | 160 ± 25 aa |
| Standard deviation of domain lengths | 24.83 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 80.45 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.66 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.31 |
| Pfam Score | 90.48 |
| Assigned Pfam label(s) | PF03298- CL0128 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| T0RFJ7 | 10-145 | TFYVSAYSECQIYLDDCEYYSCVESIKSCGKTGYPVGFGKKYCNKFEKNLNKFSHSGQNWVTNVKHCLIQEMELISEAATCSAYKTK… |
| A0A6A6IN56 | 108-262 | SAGADPPSCSNPAENTCTFYPNCLEKTMQCGPDGYPIGYGLKYCTKFTDAAPKFSAIGQAWITKTMLCLQRNLVPYATGEKSTTCSA… |
| A0A2T7PNM3 | 34-175 | None |
| A0A820AGJ1 | 25-193 | None |
| A0A819ZLN7 | 380-525 | None |
| A0A849T8U6 | 85-225 | None |
| A0A2P6NSD5 | 714-883 | None |
| D3BMJ5 | 118-257 | None |
| A0A226F2N2 | 14-145 | None |
| A0A1X7T8B1 | 21-177 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.